![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99633/179257/atl-hpa065505_anti-c18orf21-pab-atl-hpa065505_60919__44136.1681134912.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG")
Protein Description: chromosome 18 open reading frame 21
Gene Name: C18orf21
Alternative Gene Name: HsT3108, PNAS-124, PNAS-131
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024273: 65%, ENSRNOG00000015546: 63%
Entrez Gene ID: 83608
Uniprot ID: Q32NC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C18orf21
Alternative Gene Name: HsT3108, PNAS-124, PNAS-131
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024273: 65%, ENSRNOG00000015546: 63%
Entrez Gene ID: 83608
Uniprot ID: Q32NC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GQSVSTCSSKNTSKTKKHFSQLKMLLSQNESQKIPKVDFRNFLSSLKGGLL |
| Documents & Links for Anti C18orf21 pAb (ATL-HPA065505) | |
| Datasheet | Anti C18orf21 pAb (ATL-HPA065505) Datasheet (External Link) |
| Vendor Page | Anti C18orf21 pAb (ATL-HPA065505) at Atlas |
| Documents & Links for Anti C18orf21 pAb (ATL-HPA065505) | |
| Datasheet | Anti C18orf21 pAb (ATL-HPA065505) Datasheet (External Link) |
| Vendor Page | Anti C18orf21 pAb (ATL-HPA065505) |