Description
Product Description
Protein Description: chromosome 14 open reading frame 79
Gene Name: C14orf79
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037594: 63%, ENSRNOG00000013690: 66%
Entrez Gene ID: 122616
Uniprot ID: Q96F83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C14orf79
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037594: 63%, ENSRNOG00000013690: 66%
Entrez Gene ID: 122616
Uniprot ID: Q96F83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SRCQENFFLVLGIDAAQKNLSGGQGHIMEDCDLKEPEGLLTVSSFCLQHCKALIQTKLSGPPGSKQGRLMTCSRFLKTPSCGGGQHITIPRKRMFTPRKL |
Gene Sequence | SRCQENFFLVLGIDAAQKNLSGGQGHIMEDCDLKEPEGLLTVSSFCLQHCKALIQTKLSGPPGSKQGRLMTCSRFLKTPSCGGGQHITIPRKRMFTPRKL |
Gene ID - Mouse | ENSMUSG00000037594 |
Gene ID - Rat | ENSRNOG00000013690 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C14orf79 pAb (ATL-HPA061117) | |
Datasheet | Anti C14orf79 pAb (ATL-HPA061117) Datasheet (External Link) |
Vendor Page | Anti C14orf79 pAb (ATL-HPA061117) at Atlas Antibodies |
Documents & Links for Anti C14orf79 pAb (ATL-HPA061117) | |
Datasheet | Anti C14orf79 pAb (ATL-HPA061117) Datasheet (External Link) |
Vendor Page | Anti C14orf79 pAb (ATL-HPA061117) |