Anti C14orf79 pAb (ATL-HPA061117)

Catalog No:
ATL-HPA061117-25
$395.00

Description

Product Description

Protein Description: chromosome 14 open reading frame 79
Gene Name: C14orf79
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037594: 63%, ENSRNOG00000013690: 66%
Entrez Gene ID: 122616
Uniprot ID: Q96F83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRCQENFFLVLGIDAAQKNLSGGQGHIMEDCDLKEPEGLLTVSSFCLQHCKALIQTKLSGPPGSKQGRLMTCSRFLKTPSCGGGQHITIPRKRMFTPRKL
Gene Sequence SRCQENFFLVLGIDAAQKNLSGGQGHIMEDCDLKEPEGLLTVSSFCLQHCKALIQTKLSGPPGSKQGRLMTCSRFLKTPSCGGGQHITIPRKRMFTPRKL
Gene ID - Mouse ENSMUSG00000037594
Gene ID - Rat ENSRNOG00000013690
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti C14orf79 pAb (ATL-HPA061117)
Datasheet Anti C14orf79 pAb (ATL-HPA061117) Datasheet (External Link)
Vendor Page Anti C14orf79 pAb (ATL-HPA061117) at Atlas Antibodies

Documents & Links for Anti C14orf79 pAb (ATL-HPA061117)
Datasheet Anti C14orf79 pAb (ATL-HPA061117) Datasheet (External Link)
Vendor Page Anti C14orf79 pAb (ATL-HPA061117)

Product Description

Protein Description: chromosome 14 open reading frame 79
Gene Name: C14orf79
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037594: 63%, ENSRNOG00000013690: 66%
Entrez Gene ID: 122616
Uniprot ID: Q96F83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRCQENFFLVLGIDAAQKNLSGGQGHIMEDCDLKEPEGLLTVSSFCLQHCKALIQTKLSGPPGSKQGRLMTCSRFLKTPSCGGGQHITIPRKRMFTPRKL
Gene Sequence SRCQENFFLVLGIDAAQKNLSGGQGHIMEDCDLKEPEGLLTVSSFCLQHCKALIQTKLSGPPGSKQGRLMTCSRFLKTPSCGGGQHITIPRKRMFTPRKL
Gene ID - Mouse ENSMUSG00000037594
Gene ID - Rat ENSRNOG00000013690
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti C14orf79 pAb (ATL-HPA061117)
Datasheet Anti C14orf79 pAb (ATL-HPA061117) Datasheet (External Link)
Vendor Page Anti C14orf79 pAb (ATL-HPA061117) at Atlas Antibodies

Documents & Links for Anti C14orf79 pAb (ATL-HPA061117)
Datasheet Anti C14orf79 pAb (ATL-HPA061117) Datasheet (External Link)
Vendor Page Anti C14orf79 pAb (ATL-HPA061117)