Anti C14orf39 pAb (ATL-HPA059518)

Atlas Antibodies

Catalog No: ATL-HPA059518-25

• 
• 

Product Description

Protein Description: chromosome 14 open reading frame 39
Gene Name: C14orf39
Alternative Gene Name: SIX6OS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021098: 60%, ENSRNOG00000031655: 56%
Entrez Gene ID: 317761
Uniprot ID: Q8N1H7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVDEMEIEINYLNQQISRHNETKALSETLEEKNKNTENRKELKERIFGKDEHVLTLNKTQSSQLFLPYESQKLVRPIK
• Gene Sequence: EVDEMEIEINYLNQQISRHNETKALSETLEEKNKNTENRKELKERIFGKDEHVLTLNKTQSSQLFLPYESQKLVRPIK
• Gene ID - Mouse: ENSMUSG00000021098
• Gene ID - Rat: ENSRNOG00000031655
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.