Description
Product Description
Protein Description: chromosome 14 open reading frame 178
Gene Name: C14orf178
Alternative Gene Name: FLJ25976
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037013: 34%, ENSRNOG00000016800: 34%
Entrez Gene ID: 283579
Uniprot ID: Q8N769
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C14orf178
Alternative Gene Name: FLJ25976
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037013: 34%, ENSRNOG00000016800: 34%
Entrez Gene ID: 283579
Uniprot ID: Q8N769
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MGREMKKTGTPRPFRIEDPNQQPTWHDQPEMGSHYFAQ |
Gene Sequence | MGREMKKTGTPRPFRIEDPNQQPTWHDQPEMGSHYFAQ |
Gene ID - Mouse | ENSMUSG00000037013 |
Gene ID - Rat | ENSRNOG00000016800 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C14orf178 pAb (ATL-HPA062581) | |
Datasheet | Anti C14orf178 pAb (ATL-HPA062581) Datasheet (External Link) |
Vendor Page | Anti C14orf178 pAb (ATL-HPA062581) at Atlas Antibodies |
Documents & Links for Anti C14orf178 pAb (ATL-HPA062581) | |
Datasheet | Anti C14orf178 pAb (ATL-HPA062581) Datasheet (External Link) |
Vendor Page | Anti C14orf178 pAb (ATL-HPA062581) |