Anti C14orf178 pAb (ATL-HPA062581)

Atlas Antibodies

Catalog No: ATL-HPA062581-25

• 

Product Description

Protein Description: chromosome 14 open reading frame 178
Gene Name: C14orf178
Alternative Gene Name: FLJ25976
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037013: 34%, ENSRNOG00000016800: 34%
Entrez Gene ID: 283579
Uniprot ID: Q8N769
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGREMKKTGTPRPFRIEDPNQQPTWHDQPEMGSHYFAQ
• Gene Sequence: MGREMKKTGTPRPFRIEDPNQQPTWHDQPEMGSHYFAQ
• Gene ID - Mouse: ENSMUSG00000037013
• Gene ID - Rat: ENSRNOG00000016800
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.