Protein Description: chromosome 12 open reading frame 75
Gene Name: C12orf75
Alternative Gene Name: AGD3, OCC-1, OCC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000087651: 85%, ENSRNOG00000060879: 52%
Entrez Gene ID: 387882
Uniprot ID: Q8TAD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C12orf75
Alternative Gene Name: AGD3, OCC-1, OCC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000087651: 85%, ENSRNOG00000060879: 52%
Entrez Gene ID: 387882
Uniprot ID: Q8TAD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRK |
| Documents & Links for Anti C12orf75 pAb (ATL-HPA065311) | |
| Datasheet | Anti C12orf75 pAb (ATL-HPA065311) Datasheet (External Link) |
| Vendor Page | Anti C12orf75 pAb (ATL-HPA065311) at Atlas |
| Documents & Links for Anti C12orf75 pAb (ATL-HPA065311) | |
| Datasheet | Anti C12orf75 pAb (ATL-HPA065311) Datasheet (External Link) |
| Vendor Page | Anti C12orf75 pAb (ATL-HPA065311) |
| Citations for Anti C12orf75 pAb (ATL-HPA065311) – 1 Found |
| Evangelou, Petros; Groll, Mathias; Oppermann, Henry; Gaunitz, Frank; Eisenlöffel, Christian; Müller, Wolf; Eschrich, Klaus; Schänzer, Anne; Nestler, Ulf. Assessment of ApoC1, LuzP6, C12orf75 and OCC-1 in cystic glioblastoma using MALDI-TOF mass spectrometry, immunohistochemistry and qRT-PCR. Medical Molecular Morphology. 2019;52(4):217-225. PubMed |