Description
Product Description
Protein Description: chromosome 12 open reading frame 57
Gene Name: C12orf57
Alternative Gene Name: C10, GRCC10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072772: 97%, ENSRNOG00000050660: 97%
Entrez Gene ID: 113246
Uniprot ID: Q99622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C12orf57
Alternative Gene Name: C10, GRCC10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072772: 97%, ENSRNOG00000050660: 97%
Entrez Gene ID: 113246
Uniprot ID: Q99622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EVIKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPAAGGSV |
Gene Sequence | EVIKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPAAGGSV |
Gene ID - Mouse | ENSMUSG00000072772 |
Gene ID - Rat | ENSRNOG00000050660 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C12orf57 pAb (ATL-HPA066043) | |
Datasheet | Anti C12orf57 pAb (ATL-HPA066043) Datasheet (External Link) |
Vendor Page | Anti C12orf57 pAb (ATL-HPA066043) at Atlas Antibodies |
Documents & Links for Anti C12orf57 pAb (ATL-HPA066043) | |
Datasheet | Anti C12orf57 pAb (ATL-HPA066043) Datasheet (External Link) |
Vendor Page | Anti C12orf57 pAb (ATL-HPA066043) |