Anti C12orf54 pAb (ATL-HPA073090)

Catalog No:
ATL-HPA073090-25
$447.00

Description

Product Description

Protein Description: chromosome 12 open reading frame 54
Gene Name: C12orf54
Alternative Gene Name: MGC35033
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099353: 61%,
Entrez Gene ID: 121273
Uniprot ID: Q6X4T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAQHPCQDQEQKVEMTSKQQRSTSIEETMRPQEKQVTITETLWDQVLTVFKDIQKELQEDARIR
Gene Sequence MAQHPCQDQEQKVEMTSKQQRSTSIEETMRPQEKQVTITETLWDQVLTVFKDIQKELQEDARIR
Gene ID - Mouse ENSMUSG00000099353
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti C12orf54 pAb (ATL-HPA073090)
Datasheet Anti C12orf54 pAb (ATL-HPA073090) Datasheet (External Link)
Vendor Page Anti C12orf54 pAb (ATL-HPA073090) at Atlas Antibodies

Documents & Links for Anti C12orf54 pAb (ATL-HPA073090)
Datasheet Anti C12orf54 pAb (ATL-HPA073090) Datasheet (External Link)
Vendor Page Anti C12orf54 pAb (ATL-HPA073090)

Product Description

Protein Description: chromosome 12 open reading frame 54
Gene Name: C12orf54
Alternative Gene Name: MGC35033
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099353: 61%,
Entrez Gene ID: 121273
Uniprot ID: Q6X4T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAQHPCQDQEQKVEMTSKQQRSTSIEETMRPQEKQVTITETLWDQVLTVFKDIQKELQEDARIR
Gene Sequence MAQHPCQDQEQKVEMTSKQQRSTSIEETMRPQEKQVTITETLWDQVLTVFKDIQKELQEDARIR
Gene ID - Mouse ENSMUSG00000099353
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti C12orf54 pAb (ATL-HPA073090)
Datasheet Anti C12orf54 pAb (ATL-HPA073090) Datasheet (External Link)
Vendor Page Anti C12orf54 pAb (ATL-HPA073090) at Atlas Antibodies

Documents & Links for Anti C12orf54 pAb (ATL-HPA073090)
Datasheet Anti C12orf54 pAb (ATL-HPA073090) Datasheet (External Link)
Vendor Page Anti C12orf54 pAb (ATL-HPA073090)