Protein Description: chromosome 12 open reading frame 54
Gene Name: C12orf54
Alternative Gene Name: MGC35033
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099353: 61%,
Entrez Gene ID: 121273
Uniprot ID: Q6X4T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C12orf54
Alternative Gene Name: MGC35033
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099353: 61%,
Entrez Gene ID: 121273
Uniprot ID: Q6X4T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MAQHPCQDQEQKVEMTSKQQRSTSIEETMRPQEKQVTITETLWDQVLTVFKDIQKELQEDARIR |
| Documents & Links for Anti C12orf54 pAb (ATL-HPA073090) | |
| Datasheet | Anti C12orf54 pAb (ATL-HPA073090) Datasheet (External Link) |
| Vendor Page | Anti C12orf54 pAb (ATL-HPA073090) at Atlas |
| Documents & Links for Anti C12orf54 pAb (ATL-HPA073090) | |
| Datasheet | Anti C12orf54 pAb (ATL-HPA073090) Datasheet (External Link) |
| Vendor Page | Anti C12orf54 pAb (ATL-HPA073090) |