Anti C12orf43 pAb (ATL-HPA061739)

Atlas Antibodies

Catalog No: ATL-HPA061739-25

• 

Product Description

Protein Description: chromosome 12 open reading frame 43
Gene Name: C12orf43
Alternative Gene Name: FLJ12448
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029559: 51%, ENSRNOG00000001185: 49%
Entrez Gene ID: 64897
Uniprot ID: Q96C57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KKKAKKVASVDSAVAATTPTSMATVQKQKSGELNGDQVSLGTKKKKKAK
• Gene Sequence: KKKAKKVASVDSAVAATTPTSMATVQKQKSGELNGDQVSLGTKKKKKAK
• Gene ID - Mouse: ENSMUSG00000029559
• Gene ID - Rat: ENSRNOG00000001185
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.