Protein Description: chromosome 11 open reading frame 71
Gene Name: C11orf71
Alternative Gene Name: FLJ20010
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042293: 68%, ENSRNOG00000005918: 66%
Entrez Gene ID: 54494
Uniprot ID: Q6IPW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C11orf71
Alternative Gene Name: FLJ20010
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042293: 68%, ENSRNOG00000005918: 66%
Entrez Gene ID: 54494
Uniprot ID: Q6IPW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VRPSVRAESRRVDGGGRSPREPDGRGRSRQARFSPYPIPAVEPDLLRSVL |
| Documents & Links for Anti C11orf71 pAb (ATL-HPA074787) | |
| Datasheet | Anti C11orf71 pAb (ATL-HPA074787) Datasheet (External Link) |
| Vendor Page | Anti C11orf71 pAb (ATL-HPA074787) at Atlas |
| Documents & Links for Anti C11orf71 pAb (ATL-HPA074787) | |
| Datasheet | Anti C11orf71 pAb (ATL-HPA074787) Datasheet (External Link) |
| Vendor Page | Anti C11orf71 pAb (ATL-HPA074787) |