Anti C11orf63 pAb (ATL-HPA077658 w/enhanced validation)

Catalog No:
ATL-HPA077658-25
$395.00
Protein Description: chromosome 11 open reading frame 63
Gene Name: C11orf63
Alternative Gene Name: FLJ23554
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032023: 71%, ENSRNOG00000008138: 72%
Entrez Gene ID: 79864
Uniprot ID: Q6NUN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence YAKQVKEYNMKTLSILSKPQTEKTQKKSAIPRQKALEYAKTIPKPKPSNLTHQASKEQKNPTYAGKEESLPEISLLEI
Gene ID - Mouse ENSMUSG00000032023
Gene ID - Rat ENSMUSG00000032023
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti C11orf63 pAb (ATL-HPA077658 w/enhanced validation)
Datasheet Anti C11orf63 pAb (ATL-HPA077658 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C11orf63 pAb (ATL-HPA077658 w/enhanced validation) at Atlas

Documents & Links for Anti C11orf63 pAb (ATL-HPA077658 w/enhanced validation)
Datasheet Anti C11orf63 pAb (ATL-HPA077658 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C11orf63 pAb (ATL-HPA077658 w/enhanced validation)