Protein Description: chromosome 11 open reading frame 58
Gene Name: C11orf58
Alternative Gene Name: SMAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030663: 89%, ENSRNOG00000053659: 85%
Entrez Gene ID: 10944
Uniprot ID: O00193
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C11orf58
Alternative Gene Name: SMAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030663: 89%, ENSRNOG00000053659: 85%
Entrez Gene ID: 10944
Uniprot ID: O00193
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ESDSESEKEESAEELQAAEHPDEVEDPKNKKDAKSNYKMMFVKSSGS |
| Documents & Links for Anti C11orf58 pAb (ATL-HPA076406) | |
| Datasheet | Anti C11orf58 pAb (ATL-HPA076406) Datasheet (External Link) |
| Vendor Page | Anti C11orf58 pAb (ATL-HPA076406) at Atlas |
| Documents & Links for Anti C11orf58 pAb (ATL-HPA076406) | |
| Datasheet | Anti C11orf58 pAb (ATL-HPA076406) Datasheet (External Link) |
| Vendor Page | Anti C11orf58 pAb (ATL-HPA076406) |