Protein Description: chromosome 11 open reading frame 53
Gene Name: C11orf53
Alternative Gene Name: MGC50104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036027: 78%, ENSRNOG00000012022: 81%
Entrez Gene ID: 341032
Uniprot ID: Q8IXP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C11orf53
Alternative Gene Name: MGC50104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036027: 78%, ENSRNOG00000012022: 81%
Entrez Gene ID: 341032
Uniprot ID: Q8IXP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VTSGYYGVRRSFLSDSDFHNSKQFSNDVYTSSVGKPFPCESSAGQSHAALLEPYFPQEPYGDYRPPALTPNAGSLFS |
| Documents & Links for Anti C11orf53 pAb (ATL-HPA073101) | |
| Datasheet | Anti C11orf53 pAb (ATL-HPA073101) Datasheet (External Link) |
| Vendor Page | Anti C11orf53 pAb (ATL-HPA073101) at Atlas |
| Documents & Links for Anti C11orf53 pAb (ATL-HPA073101) | |
| Datasheet | Anti C11orf53 pAb (ATL-HPA073101) Datasheet (External Link) |
| Vendor Page | Anti C11orf53 pAb (ATL-HPA073101) |