Anti C11orf42 pAb (ATL-HPA063404 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA063404-25

• 

Product Description

Protein Description: chromosome 11 open reading frame 42
Gene Name: C11orf42
Alternative Gene Name: MGC34805
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078611: 81%, ENSRNOG00000030818: 82%
Entrez Gene ID: 160298
Uniprot ID: Q8N5U0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLLRLLRSLPVAFSCLKFSLQSKGVLGPQKPLTKDPLPHGANWVRPNLSIMPPLAPTSAPAD
• Gene Sequence: QLLRLLRSLPVAFSCLKFSLQSKGVLGPQKPLTKDPLPHGANWVRPNLSIMPPLAPTSAPAD
• Gene ID - Mouse: ENSMUSG00000078611
• Gene ID - Rat: ENSRNOG00000030818
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti C11orf42 pAb (ATL-HPA063404 w/enhanced validation) – 1 Found

Jamin, Soazik P; Hikmet, Feria; Mathieu, Romain; Jégou, Bernard; Lindskog, Cecilia; Chalmel, Frédéric; Primig, Michael. Combined RNA/tissue profiling identifies novel Cancer/testis genes. Molecular Oncology. 2021;15(11):3003-3023.