Description
Product Description
Protein Description: chromosome 10 open reading frame 90
Gene Name: C10orf90
Alternative Gene Name: bA422P15.2, FATS, FLJ32938
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030994: 65%, ENSRNOG00000027542: 59%
Entrez Gene ID: 118611
Uniprot ID: Q96M02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: C10orf90
Alternative Gene Name: bA422P15.2, FATS, FLJ32938
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030994: 65%, ENSRNOG00000027542: 59%
Entrez Gene ID: 118611
Uniprot ID: Q96M02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LKLSGEGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDENKSRENRASLPLPCAIAQSRAHHAKQSLANRSGV |
Gene Sequence | LKLSGEGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDENKSRENRASLPLPCAIAQSRAHHAKQSLANRSGV |
Gene ID - Mouse | ENSMUSG00000030994 |
Gene ID - Rat | ENSRNOG00000027542 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti C10orf90 pAb (ATL-HPA075229) | |
Datasheet | Anti C10orf90 pAb (ATL-HPA075229) Datasheet (External Link) |
Vendor Page | Anti C10orf90 pAb (ATL-HPA075229) at Atlas Antibodies |
Documents & Links for Anti C10orf90 pAb (ATL-HPA075229) | |
Datasheet | Anti C10orf90 pAb (ATL-HPA075229) Datasheet (External Link) |
Vendor Page | Anti C10orf90 pAb (ATL-HPA075229) |