Anti BTLA pAb (ATL-HPA062029 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062029-25

• 

Product Description

Protein Description: B and T lymphocyte associated
Gene Name: BTLA
Alternative Gene Name: BTLA1, CD272
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052013: 57%, ENSRNOG00000030246: 58%
Entrez Gene ID: 151888
Uniprot ID: Q7Z6A9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPTE
• Gene Sequence: ETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPTE
• Gene ID - Mouse: ENSMUSG00000052013
• Gene ID - Rat: ENSRNOG00000030246
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.