Anti BTG4 pAb (ATL-HPA057157)

Atlas Antibodies

Catalog No: ATL-HPA057157-25

• 

Product Description

Protein Description: B-cell translocation gene 4
Gene Name: BTG4
Alternative Gene Name: PC3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032056: 87%, ENSRNOG00000011277: 89%
Entrez Gene ID: 54766
Uniprot ID: Q9NY30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFE
• Gene Sequence: GQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFE
• Gene ID - Mouse: ENSMUSG00000032056
• Gene ID - Rat: ENSRNOG00000011277
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.