![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line NTERA-2](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99942/179663/atl-hpa067026_anti-btf3l4-pab-atl-hpa067026_61325__45050.1681135409.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line NTERA-2")
Protein Description: basic transcription factor 3-like 4
Gene Name: BTF3L4
Alternative Gene Name: MGC23908
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028568: 100%, ENSRNOG00000008512: 100%
Entrez Gene ID: 91408
Uniprot ID: Q96K17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BTF3L4
Alternative Gene Name: MGC23908
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028568: 100%, ENSRNOG00000008512: 100%
Entrez Gene ID: 91408
Uniprot ID: Q96K17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDV |
| Documents & Links for Anti BTF3L4 pAb (ATL-HPA067026) | |
| Datasheet | Anti BTF3L4 pAb (ATL-HPA067026) Datasheet (External Link) |
| Vendor Page | Anti BTF3L4 pAb (ATL-HPA067026) at Atlas |
| Documents & Links for Anti BTF3L4 pAb (ATL-HPA067026) | |
| Datasheet | Anti BTF3L4 pAb (ATL-HPA067026) Datasheet (External Link) |
| Vendor Page | Anti BTF3L4 pAb (ATL-HPA067026) |