Anti BTBD11 pAb (ATL-HPA061334)

Atlas Antibodies

Catalog No: ATL-HPA061334-25

• 

Product Description

Protein Description: BTB domain containing 11
Gene Name: BTBD11
Alternative Gene Name: ABTB2B, FLJ33957
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020042: 98%, ENSRNOG00000005758: 98%
Entrez Gene ID: 121551
Uniprot ID: A6QL63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AMHHLQPLNAKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQMEWENPNVEPSKVNLQVERP
• Gene Sequence: AMHHLQPLNAKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQMEWENPNVEPSKVNLQVERP
• Gene ID - Mouse: ENSMUSG00000020042
• Gene ID - Rat: ENSRNOG00000005758
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.