Anti BTBD1 pAb (ATL-HPA067671 w/enhanced validation)

Catalog No:
ATL-HPA067671-25
$447.00

Description

Product Description

Protein Description: BTB (POZ) domain containing 1
Gene Name: BTBD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025103: 97%, ENSRNOG00000019529: 97%
Entrez Gene ID: 53339
Uniprot ID: Q9H0C5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSLGPLLPLQREPLYNWQATKASLKERFAFL
Gene Sequence SSLGPLLPLQREPLYNWQATKASLKERFAFL
Gene ID - Mouse ENSMUSG00000025103
Gene ID - Rat ENSRNOG00000019529
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti BTBD1 pAb (ATL-HPA067671 w/enhanced validation)
Datasheet Anti BTBD1 pAb (ATL-HPA067671 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BTBD1 pAb (ATL-HPA067671 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BTBD1 pAb (ATL-HPA067671 w/enhanced validation)
Datasheet Anti BTBD1 pAb (ATL-HPA067671 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BTBD1 pAb (ATL-HPA067671 w/enhanced validation)

Product Description

Protein Description: BTB (POZ) domain containing 1
Gene Name: BTBD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025103: 97%, ENSRNOG00000019529: 97%
Entrez Gene ID: 53339
Uniprot ID: Q9H0C5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSLGPLLPLQREPLYNWQATKASLKERFAFL
Gene Sequence SSLGPLLPLQREPLYNWQATKASLKERFAFL
Gene ID - Mouse ENSMUSG00000025103
Gene ID - Rat ENSRNOG00000019529
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti BTBD1 pAb (ATL-HPA067671 w/enhanced validation)
Datasheet Anti BTBD1 pAb (ATL-HPA067671 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BTBD1 pAb (ATL-HPA067671 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BTBD1 pAb (ATL-HPA067671 w/enhanced validation)
Datasheet Anti BTBD1 pAb (ATL-HPA067671 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BTBD1 pAb (ATL-HPA067671 w/enhanced validation)