Protein Description: B-box and SPRY domain containing
Gene Name: BSPRY
Alternative Gene Name: FLJ20150
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028392: 82%, ENSRNOG00000015105: 75%
Entrez Gene ID: 54836
Uniprot ID: Q5W0U4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BSPRY
Alternative Gene Name: FLJ20150
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028392: 82%, ENSRNOG00000015105: 75%
Entrez Gene ID: 54836
Uniprot ID: Q5W0U4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEI |
| Documents & Links for Anti BSPRY pAb (ATL-HPA077485) | |
| Datasheet | Anti BSPRY pAb (ATL-HPA077485) Datasheet (External Link) |
| Vendor Page | Anti BSPRY pAb (ATL-HPA077485) at Atlas |
| Documents & Links for Anti BSPRY pAb (ATL-HPA077485) | |
| Datasheet | Anti BSPRY pAb (ATL-HPA077485) Datasheet (External Link) |
| Vendor Page | Anti BSPRY pAb (ATL-HPA077485) |