Protein Description: bone morphogenetic protein/retinoic acid inducible neural-specific 3
Gene Name: BRINP3
Alternative Gene Name: DBCCR1L, DBCCR1L1, FAM5C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035131: 100%, ENSRNOG00000002811: 100%
Entrez Gene ID: 339479
Uniprot ID: Q76B58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BRINP3
Alternative Gene Name: DBCCR1L, DBCCR1L1, FAM5C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035131: 100%, ENSRNOG00000002811: 100%
Entrez Gene ID: 339479
Uniprot ID: Q76B58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FLYCNENGLLGSFSEETHSCTCPNDQVVCTAFLPCTVGDASACLTCAPDNRTR |
Gene Sequence | FLYCNENGLLGSFSEETHSCTCPNDQVVCTAFLPCTVGDASACLTCAPDNRTR |
Gene ID - Mouse | ENSMUSG00000035131 |
Gene ID - Rat | ENSRNOG00000002811 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BRINP3 pAb (ATL-HPA054693) | |
Datasheet | Anti BRINP3 pAb (ATL-HPA054693) Datasheet (External Link) |
Vendor Page | Anti BRINP3 pAb (ATL-HPA054693) at Atlas Antibodies |
Documents & Links for Anti BRINP3 pAb (ATL-HPA054693) | |
Datasheet | Anti BRINP3 pAb (ATL-HPA054693) Datasheet (External Link) |
Vendor Page | Anti BRINP3 pAb (ATL-HPA054693) |