Anti BRINP3 pAb (ATL-HPA054693)

Catalog No:
ATL-HPA054693-25
$303.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: bone morphogenetic protein/retinoic acid inducible neural-specific 3
Gene Name: BRINP3
Alternative Gene Name: DBCCR1L, DBCCR1L1, FAM5C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035131: 100%, ENSRNOG00000002811: 100%
Entrez Gene ID: 339479
Uniprot ID: Q76B58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLYCNENGLLGSFSEETHSCTCPNDQVVCTAFLPCTVGDASACLTCAPDNRTR
Gene Sequence FLYCNENGLLGSFSEETHSCTCPNDQVVCTAFLPCTVGDASACLTCAPDNRTR
Gene ID - Mouse ENSMUSG00000035131
Gene ID - Rat ENSRNOG00000002811
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BRINP3 pAb (ATL-HPA054693)
Datasheet Anti BRINP3 pAb (ATL-HPA054693) Datasheet (External Link)
Vendor Page Anti BRINP3 pAb (ATL-HPA054693) at Atlas Antibodies

Documents & Links for Anti BRINP3 pAb (ATL-HPA054693)
Datasheet Anti BRINP3 pAb (ATL-HPA054693) Datasheet (External Link)
Vendor Page Anti BRINP3 pAb (ATL-HPA054693)