Protein Description: BRICHOS domain containing 5
Gene Name: BRICD5
Alternative Gene Name: C16orf79, MGC21830
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045744: 63%, ENSRNOG00000009611: 71%
Entrez Gene ID: 283870
Uniprot ID: Q6PL45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BRICD5
Alternative Gene Name: C16orf79, MGC21830
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045744: 63%, ENSRNOG00000009611: 71%
Entrez Gene ID: 283870
Uniprot ID: Q6PL45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SLEVDPAQAGALVQRLCMRTPIYWARRAEGPRRQRLIY |
| Documents & Links for Anti BRICD5 pAb (ATL-HPA063522) | |
| Datasheet | Anti BRICD5 pAb (ATL-HPA063522) Datasheet (External Link) |
| Vendor Page | Anti BRICD5 pAb (ATL-HPA063522) at Atlas |
| Documents & Links for Anti BRICD5 pAb (ATL-HPA063522) | |
| Datasheet | Anti BRICD5 pAb (ATL-HPA063522) Datasheet (External Link) |
| Vendor Page | Anti BRICD5 pAb (ATL-HPA063522) |