Description
Product Description
Protein Description: BRF1, RNA polymerase III transcription initiation factor subunit
Gene Name: BRF1
Alternative Gene Name: BRF, GTF3B, hBRF, TAF3B2, TAF3C, TFIIIB90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011158: 96%, ENSRNOG00000014595: 96%
Entrez Gene ID: 2972
Uniprot ID: Q92994
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BRF1
Alternative Gene Name: BRF, GTF3B, hBRF, TAF3B2, TAF3C, TFIIIB90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011158: 96%, ENSRNOG00000014595: 96%
Entrez Gene ID: 2972
Uniprot ID: Q92994
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQ |
Gene Sequence | ASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQ |
Gene ID - Mouse | ENSMUSG00000011158 |
Gene ID - Rat | ENSRNOG00000014595 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti BRF1 pAb (ATL-HPA074990) | |
Datasheet | Anti BRF1 pAb (ATL-HPA074990) Datasheet (External Link) |
Vendor Page | Anti BRF1 pAb (ATL-HPA074990) at Atlas Antibodies |
Documents & Links for Anti BRF1 pAb (ATL-HPA074990) | |
Datasheet | Anti BRF1 pAb (ATL-HPA074990) Datasheet (External Link) |
Vendor Page | Anti BRF1 pAb (ATL-HPA074990) |