Protein Description: bromodomain containing 9
Gene Name: BRD9
Alternative Gene Name: FLJ13441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057649: 86%, ENSRNOG00000015676: 90%
Entrez Gene ID: 65980
Uniprot ID: Q9H8M2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BRD9
Alternative Gene Name: FLJ13441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057649: 86%, ENSRNOG00000015676: 90%
Entrez Gene ID: 65980
Uniprot ID: Q9H8M2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DDSHLNLDETTKLLQDLHEAQAERGGSRPSSNLSSLSNASERDQHHLGSPSRLSVGEQPDVTHDPYEFLQS |
Documents & Links for Anti BRD9 pAb (ATL-HPA023197) | |
Datasheet | Anti BRD9 pAb (ATL-HPA023197) Datasheet (External Link) |
Vendor Page | Anti BRD9 pAb (ATL-HPA023197) at Atlas |
Documents & Links for Anti BRD9 pAb (ATL-HPA023197) | |
Datasheet | Anti BRD9 pAb (ATL-HPA023197) Datasheet (External Link) |
Vendor Page | Anti BRD9 pAb (ATL-HPA023197) |