Description
Product Description
Protein Description: BRCA1-associated ATM activator 1
Gene Name: BRAT1
Alternative Gene Name: BAAT1, C7orf27, MGC22916
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000148: 77%, ENSRNOG00000001236: 78%
Entrez Gene ID: 221927
Uniprot ID: Q6PJG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BRAT1
Alternative Gene Name: BAAT1, C7orf27, MGC22916
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000148: 77%, ENSRNOG00000001236: 78%
Entrez Gene ID: 221927
Uniprot ID: Q6PJG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LSCLGPTHMGPLALGILKLEHCPQALRTQAFQVLLQPLACVLKATVQAPGPPGLLDGTADDATTVDTLLASKSSCAGLLCRTLAHL |
Gene Sequence | LSCLGPTHMGPLALGILKLEHCPQALRTQAFQVLLQPLACVLKATVQAPGPPGLLDGTADDATTVDTLLASKSSCAGLLCRTLAHL |
Gene ID - Mouse | ENSMUSG00000000148 |
Gene ID - Rat | ENSRNOG00000001236 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti BRAT1 pAb (ATL-HPA076508) | |
Datasheet | Anti BRAT1 pAb (ATL-HPA076508) Datasheet (External Link) |
Vendor Page | Anti BRAT1 pAb (ATL-HPA076508) at Atlas Antibodies |
Documents & Links for Anti BRAT1 pAb (ATL-HPA076508) | |
Datasheet | Anti BRAT1 pAb (ATL-HPA076508) Datasheet (External Link) |
Vendor Page | Anti BRAT1 pAb (ATL-HPA076508) |