Protein Description: B-Raf proto-oncogene, serine/threonine kinase
Gene Name: BRAF
Alternative Gene Name: BRAF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002413: 100%, ENSRNOG00000010957: 100%
Entrez Gene ID: 673
Uniprot ID: P15056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BRAF
Alternative Gene Name: BRAF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002413: 100%, ENSRNOG00000010957: 100%
Entrez Gene ID: 673
Uniprot ID: P15056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQL |
| Documents & Links for Anti BRAF pAb (ATL-HPA071048) | |
| Datasheet | Anti BRAF pAb (ATL-HPA071048) Datasheet (External Link) |
| Vendor Page | Anti BRAF pAb (ATL-HPA071048) at Atlas |
| Documents & Links for Anti BRAF pAb (ATL-HPA071048) | |
| Datasheet | Anti BRAF pAb (ATL-HPA071048) Datasheet (External Link) |
| Vendor Page | Anti BRAF pAb (ATL-HPA071048) |