Anti BPIFA3 pAb (ATL-HPA062708 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062708-25

• 

Product Description

Protein Description: BPI fold containing family A, member 3
Gene Name: BPIFA3
Alternative Gene Name: bA49G10.4, C20orf71, SPLUNC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027482: 69%, ENSRNOG00000013778: 70%
Entrez Gene ID: 128861
Uniprot ID: Q9BQP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPWPGLAQAHRDNKSTLARIIAQGLIKHNAESRIQNIHFGDRLNASAQVAPGLVGWLISGR
• Gene Sequence: QPWPGLAQAHRDNKSTLARIIAQGLIKHNAESRIQNIHFGDRLNASAQVAPGLVGWLISGR
• Gene ID - Mouse: ENSMUSG00000027482
• Gene ID - Rat: ENSRNOG00000013778
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.