Anti BPI pAb (ATL-HPA061284 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA061284-25

• 

Product Description

Protein Description: bactericidal/permeability-increasing protein
Gene Name: BPI
Alternative Gene Name: BPIFD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052922: 57%, ENSRNOG00000034195: 59%
Entrez Gene ID: 671
Uniprot ID: P17213
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTGSMEVSAESNRLVGELKLDRLLLELKHSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQP
• Gene Sequence: TTGSMEVSAESNRLVGELKLDRLLLELKHSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQP
• Gene ID - Mouse: ENSMUSG00000052922
• Gene ID - Rat: ENSRNOG00000034195
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.