Anti BOC pAb (ATL-HPA061787)

Atlas Antibodies

Catalog No: ATL-HPA061787-25

• 

Product Description

Protein Description: BOC cell adhesion associated, oncogene regulated
Gene Name: BOC
Alternative Gene Name: CDON2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022687: 56%, ENSRNOG00000002041: 54%
Entrez Gene ID: 91653
Uniprot ID: Q9BWV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSITPRLWQDAELATGTPPVSPSKLGNPEQMLRGQPALPRPPTSVGPASPQCPGEKGQGAPAEAPIILSS
• Gene Sequence: PSITPRLWQDAELATGTPPVSPSKLGNPEQMLRGQPALPRPPTSVGPASPQCPGEKGQGAPAEAPIILSS
• Gene ID - Mouse: ENSMUSG00000022687
• Gene ID - Rat: ENSRNOG00000002041
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.