Anti BNC1 pAb (ATL-HPA066947)

Atlas Antibodies

Catalog No: ATL-HPA066947-25

• 
• 

Product Description

Protein Description: basonuclin 1
Gene Name: BNC1
Alternative Gene Name: BNC, HsT19447
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025105: 79%, ENSRNOG00000019770: 77%
Entrez Gene ID: 646
Uniprot ID: Q01954
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REVEDGGHEHYFTPGMEPQVPFSDYMELQQRLLAGGLFSALSNRGMAFPCLEDSKELEHVGQHALARQIEENRFQCD
• Gene Sequence: REVEDGGHEHYFTPGMEPQVPFSDYMELQQRLLAGGLFSALSNRGMAFPCLEDSKELEHVGQHALARQIEENRFQCD
• Gene ID - Mouse: ENSMUSG00000025105
• Gene ID - Rat: ENSRNOG00000019770
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.