Protein Description: basonuclin 1
Gene Name: BNC1
Alternative Gene Name: BNC, HsT19447
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025105: 79%, ENSRNOG00000019770: 77%
Entrez Gene ID: 646
Uniprot ID: Q01954
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BNC1
Alternative Gene Name: BNC, HsT19447
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025105: 79%, ENSRNOG00000019770: 77%
Entrez Gene ID: 646
Uniprot ID: Q01954
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | REVEDGGHEHYFTPGMEPQVPFSDYMELQQRLLAGGLFSALSNRGMAFPCLEDSKELEHVGQHALARQIEENRFQCD |
| Documents & Links for Anti BNC1 pAb (ATL-HPA066947) | |
| Datasheet | Anti BNC1 pAb (ATL-HPA066947) Datasheet (External Link) |
| Vendor Page | Anti BNC1 pAb (ATL-HPA066947) at Atlas |
| Documents & Links for Anti BNC1 pAb (ATL-HPA066947) | |
| Datasheet | Anti BNC1 pAb (ATL-HPA066947) Datasheet (External Link) |
| Vendor Page | Anti BNC1 pAb (ATL-HPA066947) |