Protein Description: basonuclin 1
Gene Name: BNC1
Alternative Gene Name: BNC, HsT19447
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025105: 91%, ENSRNOG00000019770: 91%
Entrez Gene ID: 646
Uniprot ID: Q01954
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BNC1
Alternative Gene Name: BNC, HsT19447
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025105: 91%, ENSRNOG00000019770: 91%
Entrez Gene ID: 646
Uniprot ID: Q01954
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LSQEALESSEDHFRAAYLLKDVAKEAYQDVAFTQQASQTSVIFKGTSRMGSLVYPITQVHSASLESYNSGPLSEGTILDLSTTSSMKS |
| Documents & Links for Anti BNC1 pAb (ATL-HPA063183) | |
| Datasheet | Anti BNC1 pAb (ATL-HPA063183) Datasheet (External Link) |
| Vendor Page | Anti BNC1 pAb (ATL-HPA063183) at Atlas |
| Documents & Links for Anti BNC1 pAb (ATL-HPA063183) | |
| Datasheet | Anti BNC1 pAb (ATL-HPA063183) Datasheet (External Link) |
| Vendor Page | Anti BNC1 pAb (ATL-HPA063183) |
| Citations for Anti BNC1 pAb (ATL-HPA063183) – 1 Found |
| Gambardella, Laure; McManus, Sophie A; Moignard, Victoria; Sebukhan, Derya; Delaune, Agathe; Andrews, Simon; Bernard, William G; Morrison, Maura A; Riley, Paul R; Göttgens, Berthold; Gambardella Le Novère, Nicolas; Sinha, Sanjay. BNC1 regulates cell heterogeneity in human pluripotent stem cell-derived epicardium. Development (Cambridge, England). 2019;146(24) PubMed |