Description
Product Description
Protein Description: bone morphogenetic protein 7
Gene Name: BMP7
Alternative Gene Name: OP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008999: 95%, ENSRNOG00000053384: 95%
Entrez Gene ID: 655
Uniprot ID: P18075
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BMP7
Alternative Gene Name: OP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008999: 95%, ENSRNOG00000053384: 95%
Entrez Gene ID: 655
Uniprot ID: P18075
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AFFKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKH |
| Gene Sequence | AFFKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKH |
| Gene ID - Mouse | ENSMUSG00000008999 |
| Gene ID - Rat | ENSRNOG00000053384 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti BMP7 pAb (ATL-HPA057757) | |
| Datasheet | Anti BMP7 pAb (ATL-HPA057757) Datasheet (External Link) |
| Vendor Page | Anti BMP7 pAb (ATL-HPA057757) at Atlas Antibodies |
| Documents & Links for Anti BMP7 pAb (ATL-HPA057757) | |
| Datasheet | Anti BMP7 pAb (ATL-HPA057757) Datasheet (External Link) |
| Vendor Page | Anti BMP7 pAb (ATL-HPA057757) |