Protein Description: BMI1 proto-oncogene, polycomb ring finger
Gene Name: BMI1
Alternative Gene Name: PCGF4, RNF51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026739: 94%, ENSRNOG00000016585: 86%
Entrez Gene ID: 648
Uniprot ID: P35226
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BMI1
Alternative Gene Name: PCGF4, RNF51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026739: 94%, ENSRNOG00000016585: 86%
Entrez Gene ID: 648
Uniprot ID: P35226
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYE |
| Documents & Links for Anti BMI1 pAb (ATL-HPA030471) | |
| Datasheet | Anti BMI1 pAb (ATL-HPA030471) Datasheet (External Link) |
| Vendor Page | Anti BMI1 pAb (ATL-HPA030471) at Atlas |
| Documents & Links for Anti BMI1 pAb (ATL-HPA030471) | |
| Datasheet | Anti BMI1 pAb (ATL-HPA030471) Datasheet (External Link) |
| Vendor Page | Anti BMI1 pAb (ATL-HPA030471) |