Description
Product Description
Protein Description: bleomycin hydrolase
Gene Name: BLMH
Alternative Gene Name: BH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020840: 95%, ENSRNOG00000003563: 94%
Entrez Gene ID: 642
Uniprot ID: Q13867
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BLMH
Alternative Gene Name: BH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020840: 95%, ENSRNOG00000003563: 94%
Entrez Gene ID: 642
Uniprot ID: Q13867
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ITPLEFYREHVKPLFNMEDKICLVNDPRPQHKYNKLYTVEYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGK |
Gene Sequence | ITPLEFYREHVKPLFNMEDKICLVNDPRPQHKYNKLYTVEYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGK |
Gene ID - Mouse | ENSMUSG00000020840 |
Gene ID - Rat | ENSRNOG00000003563 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti BLMH pAb (ATL-HPA064307 w/enhanced validation) | |
Datasheet | Anti BLMH pAb (ATL-HPA064307 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BLMH pAb (ATL-HPA064307 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti BLMH pAb (ATL-HPA064307 w/enhanced validation) | |
Datasheet | Anti BLMH pAb (ATL-HPA064307 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BLMH pAb (ATL-HPA064307 w/enhanced validation) |