Anti BLMH pAb (ATL-HPA064307 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA064307-25

• 

Product Description

Protein Description: bleomycin hydrolase
Gene Name: BLMH
Alternative Gene Name: BH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020840: 95%, ENSRNOG00000003563: 94%
Entrez Gene ID: 642
Uniprot ID: Q13867
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITPLEFYREHVKPLFNMEDKICLVNDPRPQHKYNKLYTVEYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGK
• Gene Sequence: ITPLEFYREHVKPLFNMEDKICLVNDPRPQHKYNKLYTVEYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGK
• Gene ID - Mouse: ENSMUSG00000020840
• Gene ID - Rat: ENSRNOG00000003563
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.