Protein Description: BLK proto-oncogene, Src family tyrosine kinase
Gene Name: BLK
Alternative Gene Name: MGC10442
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014453: 84%, ENSRNOG00000010798: 86%
Entrez Gene ID: 640
Uniprot ID: P51451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BLK
Alternative Gene Name: MGC10442
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014453: 84%, ENSRNOG00000010798: 86%
Entrez Gene ID: 640
Uniprot ID: P51451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWF |
| Documents & Links for Anti BLK pAb (ATL-HPA069571) | |
| Datasheet | Anti BLK pAb (ATL-HPA069571) Datasheet (External Link) |
| Vendor Page | Anti BLK pAb (ATL-HPA069571) at Atlas |
| Documents & Links for Anti BLK pAb (ATL-HPA069571) | |
| Datasheet | Anti BLK pAb (ATL-HPA069571) Datasheet (External Link) |
| Vendor Page | Anti BLK pAb (ATL-HPA069571) |