Protein Description: baculoviral IAP repeat containing 6
Gene Name: BIRC6
Alternative Gene Name: BRUCE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024073: 99%, ENSRNOG00000027191: 99%
Entrez Gene ID: 57448
Uniprot ID: Q9NR09
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BIRC6
Alternative Gene Name: BRUCE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024073: 99%, ENSRNOG00000027191: 99%
Entrez Gene ID: 57448
Uniprot ID: Q9NR09
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GSTDNESCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSKSLHDDGFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADAA |
| Documents & Links for Anti BIRC6 pAb (ATL-HPA074738) | |
| Datasheet | Anti BIRC6 pAb (ATL-HPA074738) Datasheet (External Link) |
| Vendor Page | Anti BIRC6 pAb (ATL-HPA074738) at Atlas |
| Documents & Links for Anti BIRC6 pAb (ATL-HPA074738) | |
| Datasheet | Anti BIRC6 pAb (ATL-HPA074738) Datasheet (External Link) |
| Vendor Page | Anti BIRC6 pAb (ATL-HPA074738) |