Anti BICDL1 pAb (ATL-HPA061116 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA061116-25

• 
• 
• 

Product Description

Protein Description: BICD family like cargo adaptor 1
Gene Name: BICDL1
Alternative Gene Name: BICDR-1, CCDC64, FLJ26450
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041609: 97%, ENSRNOG00000056955: 97%
Entrez Gene ID: 92558
Uniprot ID: Q6ZP65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRLQLWEAYCQVRYLCSHLRGNDSADSAVSTDSSMDESSETSSAKDVPAGSLRTALNELKRLIQSIVDGMEPTVT
• Gene Sequence: LRLQLWEAYCQVRYLCSHLRGNDSADSAVSTDSSMDESSETSSAKDVPAGSLRTALNELKRLIQSIVDGMEPTVT
• Gene ID - Mouse: ENSMUSG00000041609
• Gene ID - Rat: ENSRNOG00000056955
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.