Protein Description: BicC family RNA binding protein 1
Gene Name: BICC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014329: 98%, ENSRNOG00000000614: 97%
Entrez Gene ID: 80114
Uniprot ID: Q9H694
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BICC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014329: 98%, ENSRNOG00000000614: 97%
Entrez Gene ID: 80114
Uniprot ID: Q9H694
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | HLAGSLASAIPVSTQLDIAAQHHLFMMGRNGSNIKHIMQRTGAQIHFPDPSNPQKKSTVYLQGTIESVCLARQYLMGCLPLVLMFDMKEEIEV |
Documents & Links for Anti BICC1 pAb (ATL-HPA070797) | |
Datasheet | Anti BICC1 pAb (ATL-HPA070797) Datasheet (External Link) |
Vendor Page | Anti BICC1 pAb (ATL-HPA070797) at Atlas |
Documents & Links for Anti BICC1 pAb (ATL-HPA070797) | |
Datasheet | Anti BICC1 pAb (ATL-HPA070797) Datasheet (External Link) |
Vendor Page | Anti BICC1 pAb (ATL-HPA070797) |