Protein Description: basic helix-loop-helix family member e41
Gene Name: BHLHE41
Alternative Gene Name: BHLHB3, bHLHe41, DEC2, SHARP-1, SHARP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030256: 61%, ENSRNOG00000048961: 61%
Entrez Gene ID: 79365
Uniprot ID: Q9C0J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BHLHE41
Alternative Gene Name: BHLHB3, bHLHe41, DEC2, SHARP-1, SHARP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030256: 61%, ENSRNOG00000048961: 61%
Entrez Gene ID: 79365
Uniprot ID: Q9C0J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GQKLEPLAYCVPVIQRTQPSAELAAENDTDTDS |
| Documents & Links for Anti BHLHE41 pAb (ATL-HPA077617) | |
| Datasheet | Anti BHLHE41 pAb (ATL-HPA077617) Datasheet (External Link) |
| Vendor Page | Anti BHLHE41 pAb (ATL-HPA077617) at Atlas |
| Documents & Links for Anti BHLHE41 pAb (ATL-HPA077617) | |
| Datasheet | Anti BHLHE41 pAb (ATL-HPA077617) Datasheet (External Link) |
| Vendor Page | Anti BHLHE41 pAb (ATL-HPA077617) |