Anti BHLHA9 pAb (ATL-HPA062632)

Atlas Antibodies

Catalog No: ATL-HPA062632-25

• 

Product Description

Protein Description: basic helix-loop-helix family, member a9
Gene Name: BHLHA9
Alternative Gene Name: bHLHa9, BHLHF42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044243: 96%, ENSRNOG00000022232: 96%
Entrez Gene ID: 727857
Uniprot ID: Q7RTU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHG
• Gene Sequence: SKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHG
• Gene ID - Mouse: ENSMUSG00000044243
• Gene ID - Rat: ENSRNOG00000022232
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.