Anti BHLHA9 pAb (ATL-HPA062632)

Catalog No:
ATL-HPA062632-25
$447.00

Description

Product Description

Protein Description: basic helix-loop-helix family, member a9
Gene Name: BHLHA9
Alternative Gene Name: bHLHa9, BHLHF42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044243: 96%, ENSRNOG00000022232: 96%
Entrez Gene ID: 727857
Uniprot ID: Q7RTU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHG
Gene Sequence SKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHG
Gene ID - Mouse ENSMUSG00000044243
Gene ID - Rat ENSRNOG00000022232
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti BHLHA9 pAb (ATL-HPA062632)
Datasheet Anti BHLHA9 pAb (ATL-HPA062632) Datasheet (External Link)
Vendor Page Anti BHLHA9 pAb (ATL-HPA062632) at Atlas Antibodies

Documents & Links for Anti BHLHA9 pAb (ATL-HPA062632)
Datasheet Anti BHLHA9 pAb (ATL-HPA062632) Datasheet (External Link)
Vendor Page Anti BHLHA9 pAb (ATL-HPA062632)

Product Description

Protein Description: basic helix-loop-helix family, member a9
Gene Name: BHLHA9
Alternative Gene Name: bHLHa9, BHLHF42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044243: 96%, ENSRNOG00000022232: 96%
Entrez Gene ID: 727857
Uniprot ID: Q7RTU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHG
Gene Sequence SKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHG
Gene ID - Mouse ENSMUSG00000044243
Gene ID - Rat ENSRNOG00000022232
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti BHLHA9 pAb (ATL-HPA062632)
Datasheet Anti BHLHA9 pAb (ATL-HPA062632) Datasheet (External Link)
Vendor Page Anti BHLHA9 pAb (ATL-HPA062632) at Atlas Antibodies

Documents & Links for Anti BHLHA9 pAb (ATL-HPA062632)
Datasheet Anti BHLHA9 pAb (ATL-HPA062632) Datasheet (External Link)
Vendor Page Anti BHLHA9 pAb (ATL-HPA062632)