Protein Description: beaded filament structural protein 2, phakinin
Gene Name: BFSP2
Alternative Gene Name: CP47, CP49, LIFL-L, phakinin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032556: 91%, ENSRNOG00000010899: 89%
Entrez Gene ID: 8419
Uniprot ID: Q13515
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BFSP2
Alternative Gene Name: CP47, CP49, LIFL-L, phakinin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032556: 91%, ENSRNOG00000010899: 89%
Entrez Gene ID: 8419
Uniprot ID: Q13515
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | YVGTAPSGCIGGLGARVTRRALGISSVFLQGLRSSGLATVPAPGLERDHGAVEDLGGCLVEYMAKVHALEQVSQELETQL |
Documents & Links for Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation) | |
Datasheet | Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation) at Atlas |
Documents & Links for Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation) | |
Datasheet | Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation) |