Protein Description: brain expressed X-linked 2
Gene Name: BEX2
Alternative Gene Name: DJ79P11.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042750: 77%, ENSRNOG00000032729: 77%
Entrez Gene ID: 84707
Uniprot ID: Q9BXY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BEX2
Alternative Gene Name: DJ79P11.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042750: 77%, ENSRNOG00000032729: 77%
Entrez Gene ID: 84707
Uniprot ID: Q9BXY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RFRVRQPILQYRWDIMHRLGEPQARMREENMERIGEEVRQLME |
| Documents & Links for Anti BEX2 pAb (ATL-HPA078630) | |
| Datasheet | Anti BEX2 pAb (ATL-HPA078630) Datasheet (External Link) |
| Vendor Page | Anti BEX2 pAb (ATL-HPA078630) at Atlas |
| Documents & Links for Anti BEX2 pAb (ATL-HPA078630) | |
| Datasheet | Anti BEX2 pAb (ATL-HPA078630) Datasheet (External Link) |
| Vendor Page | Anti BEX2 pAb (ATL-HPA078630) |