Description
Product Description
Protein Description: BEN domain containing 5
Gene Name: BEND5
Alternative Gene Name: C1orf165, FLJ11588
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028545: 98%, ENSRNOG00000008025: 96%
Entrez Gene ID: 79656
Uniprot ID: Q7L4P6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BEND5
Alternative Gene Name: C1orf165, FLJ11588
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028545: 98%, ENSRNOG00000008025: 96%
Entrez Gene ID: 79656
Uniprot ID: Q7L4P6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DLQLRHIKRPEGRKPSEVAHKSIEAVVARLEKQNGLSLGHSTCPEEVFVEASPGTEDMDSLEDAVVPRALYEELLRNYQQQQE |
Gene Sequence | DLQLRHIKRPEGRKPSEVAHKSIEAVVARLEKQNGLSLGHSTCPEEVFVEASPGTEDMDSLEDAVVPRALYEELLRNYQQQQE |
Gene ID - Mouse | ENSMUSG00000028545 |
Gene ID - Rat | ENSRNOG00000008025 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti BEND5 pAb (ATL-HPA058007) | |
Datasheet | Anti BEND5 pAb (ATL-HPA058007) Datasheet (External Link) |
Vendor Page | Anti BEND5 pAb (ATL-HPA058007) at Atlas Antibodies |
Documents & Links for Anti BEND5 pAb (ATL-HPA058007) | |
Datasheet | Anti BEND5 pAb (ATL-HPA058007) Datasheet (External Link) |
Vendor Page | Anti BEND5 pAb (ATL-HPA058007) |