Protein Description: B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB
Gene Name: BDP1
Alternative Gene Name: HSA238520, KIAA1241, KIAA1689, TAF3B1, TFC5, TFIIIB150, TFIIIB90, TFNR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049658: 78%, ENSRNOG00000017864: 80%
Entrez Gene ID: 55814
Uniprot ID: A6H8Y1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BDP1
Alternative Gene Name: HSA238520, KIAA1241, KIAA1689, TAF3B1, TFC5, TFIIIB150, TFIIIB90, TFNR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049658: 78%, ENSRNOG00000017864: 80%
Entrez Gene ID: 55814
Uniprot ID: A6H8Y1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | YAINESQRPPDRSKMTMRDFIYYLPDNNPMTSSLEQEKKTEKPSTPVQTREQEGKSTPNAEDNEMEEETDDGPLLVPRVKVAEDGSII |
Documents & Links for Anti BDP1 pAb (ATL-HPA077984) | |
Datasheet | Anti BDP1 pAb (ATL-HPA077984) Datasheet (External Link) |
Vendor Page | Anti BDP1 pAb (ATL-HPA077984) at Atlas |
Documents & Links for Anti BDP1 pAb (ATL-HPA077984) | |
Datasheet | Anti BDP1 pAb (ATL-HPA077984) Datasheet (External Link) |
Vendor Page | Anti BDP1 pAb (ATL-HPA077984) |