Protein Description: brain-derived neurotrophic factor
Gene Name: BDNF
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048482: 94%, ENSRNOG00000047466: 94%
Entrez Gene ID: 627
Uniprot ID: P23560
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BDNF
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048482: 94%, ENSRNOG00000047466: 94%
Entrez Gene ID: 627
Uniprot ID: P23560
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVT |
Gene Sequence | PMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVT |
Gene ID - Mouse | ENSMUSG00000048482 |
Gene ID - Rat | ENSRNOG00000047466 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BDNF pAb (ATL-HPA056104) | |
Datasheet | Anti BDNF pAb (ATL-HPA056104) Datasheet (External Link) |
Vendor Page | Anti BDNF pAb (ATL-HPA056104) at Atlas Antibodies |
Documents & Links for Anti BDNF pAb (ATL-HPA056104) | |
Datasheet | Anti BDNF pAb (ATL-HPA056104) Datasheet (External Link) |
Vendor Page | Anti BDNF pAb (ATL-HPA056104) |