Protein Description: brain-derived neurotrophic factor
Gene Name: BDNF
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048482: 94%, ENSRNOG00000047466: 94%
Entrez Gene ID: 627
Uniprot ID: P23560
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BDNF
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048482: 94%, ENSRNOG00000047466: 94%
Entrez Gene ID: 627
Uniprot ID: P23560
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVT |
| Documents & Links for Anti BDNF pAb (ATL-HPA056104) | |
| Datasheet | Anti BDNF pAb (ATL-HPA056104) Datasheet (External Link) |
| Vendor Page | Anti BDNF pAb (ATL-HPA056104) at Atlas |
| Documents & Links for Anti BDNF pAb (ATL-HPA056104) | |
| Datasheet | Anti BDNF pAb (ATL-HPA056104) Datasheet (External Link) |
| Vendor Page | Anti BDNF pAb (ATL-HPA056104) |