Anti BDNF pAb (ATL-HPA056104)

Catalog No:
ATL-HPA056104-100
$486.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: brain-derived neurotrophic factor
Gene Name: BDNF
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048482: 94%, ENSRNOG00000047466: 94%
Entrez Gene ID: 627
Uniprot ID: P23560
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence PMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVT
Gene ID - Mouse ENSMUSG00000048482
Gene ID - Rat ENSMUSG00000048482
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti BDNF pAb (ATL-HPA056104)
Datasheet Anti BDNF pAb (ATL-HPA056104) Datasheet (External Link)
Vendor Page Anti BDNF pAb (ATL-HPA056104) at Atlas

Documents & Links for Anti BDNF pAb (ATL-HPA056104)
Datasheet Anti BDNF pAb (ATL-HPA056104) Datasheet (External Link)
Vendor Page Anti BDNF pAb (ATL-HPA056104)