Protein Description: BCL6 corepressor-like 1
Gene Name: BCORL1
Alternative Gene Name: CXorf10, FLJ11362
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036959: 82%, ENSRNOG00000005076: 83%
Entrez Gene ID: 63035
Uniprot ID: Q5H9F3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BCORL1
Alternative Gene Name: CXorf10, FLJ11362
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036959: 82%, ENSRNOG00000005076: 83%
Entrez Gene ID: 63035
Uniprot ID: Q5H9F3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HPKELILDVVPSSRRGSSTERPQLGSQVDLGRVKMEKVDGDVVFNLATCFRADGLPVAPQRGQAEVRAKAGQARVKQESVGVFACKNKWQPDDVTESL |
| Documents & Links for Anti BCORL1 pAb (ATL-HPA068568) | |
| Datasheet | Anti BCORL1 pAb (ATL-HPA068568) Datasheet (External Link) |
| Vendor Page | Anti BCORL1 pAb (ATL-HPA068568) at Atlas |
| Documents & Links for Anti BCORL1 pAb (ATL-HPA068568) | |
| Datasheet | Anti BCORL1 pAb (ATL-HPA068568) Datasheet (External Link) |
| Vendor Page | Anti BCORL1 pAb (ATL-HPA068568) |