Protein Description: BCL6 corepressor
Gene Name: BCOR
Alternative Gene Name: FLJ20285, KIAA1575
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040363: 87%, ENSRNOG00000034240: 88%
Entrez Gene ID: 54880
Uniprot ID: Q6W2J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BCOR
Alternative Gene Name: FLJ20285, KIAA1575
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040363: 87%, ENSRNOG00000034240: 88%
Entrez Gene ID: 54880
Uniprot ID: Q6W2J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LRVDRKRKVSGDSSHTETTAEEVPEDPLLKAKRRRVSKDDWPEREMTNSSSNHLEDPHYSELTNLKVCIELTGLHPKKQRHLLHLRERWEQQVSAADGKPG |
| Documents & Links for Anti BCOR pAb (ATL-HPA073591) | |
| Datasheet | Anti BCOR pAb (ATL-HPA073591) Datasheet (External Link) |
| Vendor Page | Anti BCOR pAb (ATL-HPA073591) at Atlas |
| Documents & Links for Anti BCOR pAb (ATL-HPA073591) | |
| Datasheet | Anti BCOR pAb (ATL-HPA073591) Datasheet (External Link) |
| Vendor Page | Anti BCOR pAb (ATL-HPA073591) |