Anti BCKDK pAb (ATL-HPA056067)

Catalog No:
ATL-HPA056067-25
$447.00

Description

Product Description

Protein Description: branched chain ketoacid dehydrogenase kinase
Gene Name: BCKDK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030802: 97%, ENSRNOG00000019485: 99%
Entrez Gene ID: 10295
Uniprot ID: O14874
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TMESHLDTPYNVPDVVITIANNDVDLIIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRISPLFGHLDMHSGAQSGPMHGFGFGLP
Gene Sequence TMESHLDTPYNVPDVVITIANNDVDLIIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRISPLFGHLDMHSGAQSGPMHGFGFGLP
Gene ID - Mouse ENSMUSG00000030802
Gene ID - Rat ENSRNOG00000019485
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti BCKDK pAb (ATL-HPA056067)
Datasheet Anti BCKDK pAb (ATL-HPA056067) Datasheet (External Link)
Vendor Page Anti BCKDK pAb (ATL-HPA056067) at Atlas Antibodies

Documents & Links for Anti BCKDK pAb (ATL-HPA056067)
Datasheet Anti BCKDK pAb (ATL-HPA056067) Datasheet (External Link)
Vendor Page Anti BCKDK pAb (ATL-HPA056067)

Product Description

Protein Description: branched chain ketoacid dehydrogenase kinase
Gene Name: BCKDK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030802: 97%, ENSRNOG00000019485: 99%
Entrez Gene ID: 10295
Uniprot ID: O14874
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TMESHLDTPYNVPDVVITIANNDVDLIIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRISPLFGHLDMHSGAQSGPMHGFGFGLP
Gene Sequence TMESHLDTPYNVPDVVITIANNDVDLIIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRISPLFGHLDMHSGAQSGPMHGFGFGLP
Gene ID - Mouse ENSMUSG00000030802
Gene ID - Rat ENSRNOG00000019485
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti BCKDK pAb (ATL-HPA056067)
Datasheet Anti BCKDK pAb (ATL-HPA056067) Datasheet (External Link)
Vendor Page Anti BCKDK pAb (ATL-HPA056067) at Atlas Antibodies

Documents & Links for Anti BCKDK pAb (ATL-HPA056067)
Datasheet Anti BCKDK pAb (ATL-HPA056067) Datasheet (External Link)
Vendor Page Anti BCKDK pAb (ATL-HPA056067)