Description
Product Description
Protein Description: breast carcinoma amplified sequence 2
Gene Name: BCAS2
Alternative Gene Name: DAM1, Snt309, SPF27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005687: 100%, ENSRNOG00000018783: 100%
Entrez Gene ID: 10286
Uniprot ID: O75934
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: BCAS2
Alternative Gene Name: DAM1, Snt309, SPF27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005687: 100%, ENSRNOG00000018783: 100%
Entrez Gene ID: 10286
Uniprot ID: O75934
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLS |
Gene Sequence | MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLS |
Gene ID - Mouse | ENSMUSG00000005687 |
Gene ID - Rat | ENSRNOG00000018783 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti BCAS2 pAb (ATL-HPA067881 w/enhanced validation) | |
Datasheet | Anti BCAS2 pAb (ATL-HPA067881 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BCAS2 pAb (ATL-HPA067881 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti BCAS2 pAb (ATL-HPA067881 w/enhanced validation) | |
Datasheet | Anti BCAS2 pAb (ATL-HPA067881 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BCAS2 pAb (ATL-HPA067881 w/enhanced validation) |